SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007366 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007366
Domain Number 1 Region: 754-883,915-1126
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-71
Family p120GAP domain-like 0.00049
Further Details:      
 
Domain Number 2 Region: 1350-1447
Classification Level Classification E-value
Superfamily RGC domain-like 7.32e-32
Family RGC domain 0.0000073
Further Details:      
 
Domain Number 3 Region: 5-75
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000519
Family Calponin-homology domain, CH-domain 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000007366
Domain Number - Region: 580-648
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00226
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 471-499
Classification Level Classification E-value
Superfamily WW domain 0.00741
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007366   Gene: ENSAPLG00000007690   Transcript: ENSAPLT00000008028
Sequence length 1447
Comment pep:novel scaffold:BGI_duck_1.0:KB743276.1:142868:152866:-1 gene:ENSAPLG00000007690 transcript:ENSAPLT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLWQLFHPETTDIYDKKNMPRVVYCIHALSLYLFKLGLAPQIQDLYGKVNFTEEEINNM
QRELDKYGLQLPAFSKIGGILANELSVDEAAGEEVPGERCCALSCCQIRQLVQKKTQTWC
PKRHHDLTLLHPTPSPVHAAVLAINEAVVSPPTFFFGRSWATWSCWSRRRSGIAAANEKG
EEERASEWPRRTARSIPPWPSSAGRKWGHGHVLQVHPLAAPLYQHQLALLQRQHPRGELV
QEELFVAVEMLSAVALVNRALDAGDPDGLWSSLPGAVAVEDGNAQRYFDDLLQLKGQFRE
AGAEFLTWNDVQDCVNATNSAVQDENDSECPRGACLSRSFCKSPSELAWEKTPKNPGVTA
AAARRYHHVLTRARVLKAQATKDDRAVLWWEEIQSGVCRANEDGVAARRMALGTAAINQA
IKEGKAAQTLRVLRNPDVALRGVVDACATAYQEQLAALAATKRCAGNTKPLWVQHRLQDG
AEYFLSLQTFEGSWEKPRDGELCTTHLSREEIQSVITQVTSAHDRERLWASHVPFVVRLQ
ARLRGFLVRQQLAARWRILREEQPAALRIQAWWRGQKQRRAYLERLRYLRAHADAAVKIQ
AGVRMWQARRRYQERLRYFRRNVKAVIKIQAFVRANKARGDYRMLVHARSPPLSIVRRFI
HLLEQSQQDFWEEAEVLRLREEVVKRIRASQQLESDLDLMDIKIGLLVKNRITLQEVVSH
CKKLTKKNKEQLSEMMSLDKQKGLKALSKEKRQKLEAYQHLFYLLQTQPGYLARLIFQMP
QNKSTKFMESVIFTLYNYASNPREAYLLLQLFKAALQEEIRSKVDHIHDILTGNATVIRL
VVSFYRNARGQNALRQILGGPVQEVLQDKTLSIRTDPVDIYKAWVNQMESQSGQKSKLPY
EVSPEQALSHPEVQRRLDISVRNLLVTTDKFVSAITSSVDKIPYGMRYVAKILRTSLAEK
FPRASEEEVDKVVGNLLYYRFMNPAVVAPDGFDIVDISAGATLHPEQRRSLGSVAKVLQH
AAARKVFEGENSHLCGVNRYLEDTHAKFRRFIAAACRVPEPEERFNVDEYSELVAVAKPV
IYITIGELIDTHKLLLEHQDSIAPHHGDPLHELLEDLDELPTVQSLIGESAPSPVESSAE
AVLAQLSKMEISLTLTGKPLLEADSEESDARSLLLSTKQMLVDVIQSQPGESLPEILRTP
ASDLEEASHEHLMRRRALRDAQTPEKLKRNRSLAANSQLSVEEKKRKIIRNLRRLESLGL
VDSAHQYQGLVNELAKDIRNQRRYRQHRKGELLKLRQTLQGLDSKTLFYEEQIDYYNQYI
RTCLDNLAASNRCVYRCFSRASGKSKKLQPLRYTAARLLEKGVLLEIEELPVSQFKNVIF
DIVPCEEAGRFQVKAKFMGIDMERFQLHYQDLLQLQYEGVAVMKMFDKAKVNVNLLIFLL
NKKFFKK
Download sequence
Identical sequences U3IJE4
ENSAPLP00000007366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]