SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007396 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007396
Domain Number 1 Region: 304-356,385-587
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.43e-40
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 10-126
Classification Level Classification E-value
Superfamily ARID-like 1.57e-30
Family ARID domain 0.001
Further Details:      
 
Domain Number 3 Region: 241-300
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.38e-16
Family PHD domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1092-1161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000664
Family PHD domain 0.013
Further Details:      
 
Domain Number 5 Region: 1511-1577
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000267
Family PHD domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000007396
Domain Number - Region: 128-225
Classification Level Classification E-value
Superfamily Tropomyosin 0.000654
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007396   Gene: ENSAPLG00000007715   Transcript: ENSAPLT00000008058
Sequence length 1579
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742677.1:1059190:1095338:1 gene:ENSAPLG00000007715 transcript:ENSAPLT00000008058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKI
LDLFQLNRLVAEEGGFDVVCKERKWTKIATRMGFAPGKAVGSHIRAHYERILYPYNLFQS
GASLLCLQKPDLASDTKDKEYKPHDIPQRQSVQPSETCPPARRAKRLRAEATNMKSESEP
SEARTHNLRRRMGCAPPKCENGESRVKQRELKLPEKREHAGEPEKDKSKARSKKPTNAVR
YVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPQCLAQECNKPQ
EAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEY
GADIASKEFGSGFPVRDGKFKVRPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLP
WLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEQLEDVMKKLAPELFESQ
PDLLHQLVTIMNPNTLMAHGVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTV
DWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKAEFLDVVVASTVQKDMAIMIDDEKML
REKVQKLGVTDSERVAFELFPDDERQCLKCKTTCFMSAVYCPCKPGLLVCLYHVEDLCSC
PSYKYKLGYRYTLEELYPMMNALKMRAESYNEWASNVNEALEAKINNKRSLVSFKALIEE
SEMKKFPDNDLLRHLRLVTQDADKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRLF
VRQLYALPCVLSQTPLLKDLLDRVEAFQQQSQKLLSEEMPCAAELQELLDVSFDFDVDLP
QLAELRIRLEQARWLEDVQLASSDQNSLTLDDMRRLIDSGVGLAPYPAVEKAMAKLQELL
TVSEHWDDKARNLIKARPRPRQSLSSLVAALKEIEEIPAYLPNGVALKDAVQKAKDWLQE
VESLQVGGRVPVLDTLVELVTRGRSIPVHLDYLLRLESLVSEVQAWKECAANTFLCENSP
YSLLEVLCPRCDIGILNLKRKQKKLKEPVPSGKKKSTKLESLSDLERALSESKDTASAMA
TLGEARLKEMEALRSLRAANEVKVLSNEEDAELKVCLCQKEPAAPMIQCELCRGFFHTSC
VSVPNILQGPRVWLCPHCHRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTVNWQ
HRAQQMLYSGNLKLIQDKVGSGLLYNRWQATAGHLPETSVISRELEAASKKKGQGKWVKL
SSFLEIINALKKKKPTFMVDKAGQHCGHVTDIRETTAMEHPECDTKSSSKQLGISLDHDR
SLSVRNDFCITNKISAPRAEHAVSCKISHVCDEKMWHGRTRGISRQLAPSHMHRSELKPV
ISTELDELMMEAQLLQVSLPEIQELYQILFTKQSPTSQTEQKSSVGPTNEKNECCRGKKD
GISYMERKLKRRFERESFCDEKRARVKKMRTPKKKKLKLNHSRDLCTNKLERERERLFEM
QRSSESHLFPSDMSFSEQEDSEDEDAICPAVNCLQPEGDEVDWVQCDGSCNQWFHQVCVG
ISPEMAEKEDYICISCTGK
Download sequence
Identical sequences U3IJH4
ENSAPLP00000007396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]