SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007401 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007401
Domain Number 1 Region: 532-603
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.73e-17
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Domain Number 2 Region: 452-552
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000394
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 1073-1144
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000825
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007401   Gene: ENSAPLG00000007750   Transcript: ENSAPLT00000008063
Sequence length 1149
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742386.1:32591:104202:1 gene:ENSAPLG00000007750 transcript:ENSAPLT00000008063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKPDASPTSLQLRSQIEESLGLSSTASTPDTERKLSIHKSSSEEGSVGKADWKKKNKFFW
QNFRKNQKGLMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEA
QHRQSSTADTTDWPDGSYSTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKL
IRVEEMKKPSTEGVEEHSLDNSPILDDRSALYSGVHKKQFYFDGSCEKQPEDDSDSLTTS
PSSSSLDTWGANRKLVKTFSKTDSRGLIKPPKKLGTFFSYPEEEKTQKVCRSLTDGEMKK
SLGSLSHGRTCSFGGFDLTNRSLHIGNNSDQMGKEGDFVYKEVIKSPSASRISLGKKVKS
VKETMKKRMSKKYSSSLSEQESSPGVMPGSPQSPPPDTDSLDKPKLKAGGSVESLRSSLS
GQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSLK
LKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPTRRRRKSRPPQPK
SVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQE
YDSNSDQSGSQEKLLIEGQGLTGCSPRDSGCYESSENLENGKTRRTCHLPSKSASEHSFK
DFSRNQLSNYPTLPLTKSIETLQQGEKESRLSCSHRALKSSVQPPAVMGLKKNRRSLPVA
VCRSYETLDGPQGVDTWPRSHSLDDLQGESNTNLQDTSKKDSFPQDSLDTAKKATGSALP
PQPHGGSCMVGDLMPKQGKGAASSQKGRGKELDCSVMESAGGKPVPFPLKNCEAQAASVT
HPATRTSLEIQSKGFHDLARADYAPVLKGGLEAEQKGTNEARMQPKNPSQPPPVPAKKCR
ERLSNGLYHPSATTSGNHSSLEAPCLPVKKSSPSAPVDLHGVPAHRTSSEQEPSTPPSPL
PPWLSELPETASVQQHVVKLGPASARKVSCSRGMDLEMVIENKLQSEDIDLTEEPYSDKH
GRCGIPEALVQRYSEDLDQPEKDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPG
LITSVSDWLISIGLPMYSSPLTEAGFNTLSKVPSLSQTYLQEAGITEERHISKLLAAARL
FKPLDPEAI
Download sequence
Identical sequences U3IJH9
ENSAPLP00000007401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]