SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007449 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007449
Domain Number 1 Region: 632-793
Classification Level Classification E-value
Superfamily Bet v1-like 2.06e-35
Family STAR domain 0.00000422
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.61e-31
Family Variant SAM domain 0.00013
Further Details:      
 
Domain Number 3 Region: 451-559
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-25
Family BCR-homology GTPase activation domain (BH-domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007449   Gene: ENSAPLG00000007813   Transcript: ENSAPLT00000008111
Sequence length 793
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743210.1:708962:718816:1 gene:ENSAPLG00000007813 transcript:ENSAPLT00000008111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEAKKACDWLRAAGFPQYAQLYEDSLFPLDIGAVKRDHSFLDQDSLKSLCRRLMTLNTC
ASMKLEVHFQRKQNEDSEEEDLCAISNRWAFQRESKRWSRVGSVDGLRGAQLAMRQASSR
ESVLTDLSTNLEAVSLHSSVSTGSTSGTPGIVVTPPEPSPARDAPSGREGPKEKLKKRRS
RSFLKRIESLRRKDKEKAGPDEKGVASSGGMAKPGWDSTKSNGDLTATKGSSPKRGAATS
FHGKKHFFSVSYRTNRLLGSGRGKGSPESKRTGVYLEDYEAAVGAGSTWAAGERHILQHM
WGLQQKVELWYKAISPGLDTDSGGEPTFPSNLHFEERSMSDVGTSASDFDSTGNSLNEAE
ELEMRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSASLEIKQLNLLQKCSLLRLTAI
MEKYSVPHKQAWTWWTVPKFMKRSKAPDYRDKAVFGVPPIINVQRTGQPLPQSIQQAMRY
LRSQCLDQVGIFRKSGVKSRIQALRHMNETSPDNVNYKGQSAYDVADLLKQYFRDLPEPI
FTSKLTDTFLQIYQCKGGAGRLVPPRRAMHRRGTVGKPDQKDLNEMITDCKKLFQVSHDI
LLQLSSSYMAADAYPHPLADFVCQGESKDLHSYFEQSVQNLLKESSEKFKGWLSTPGPLN
TELSCKKPAAVMVLLHXKVSTEVEAPPSLVLHRVLRERHLWDEDLLQSKVVEALDKDMEV
YHYVPHPRRDCVVLRRWRTDLRGACLLISISVDHDKLQVEGGVKAVVLTSQYLMEPSGMG
RSKVTHICRADLR
Download sequence
Identical sequences U3IJM7
ENSAPLP00000007449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]