SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007451 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007451
Domain Number 1 Region: 696-883,1195-1278,1473-1534
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.63e-104
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000096
Further Details:      
 
Domain Number 2 Region: 137-314
Classification Level Classification E-value
Superfamily EF-hand 2.82e-26
Family Calmodulin-like 0.0019
Further Details:      
 
Domain Number 3 Region: 329-383,477-545
Classification Level Classification E-value
Superfamily DUSP-like 1.57e-22
Family DUSP, domain in ubiquitin-specific proteases 0.0036
Further Details:      
 
Domain Number 4 Region: 31-124
Classification Level Classification E-value
Superfamily EF-hand 0.0000000213
Family Calmodulin-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000007451
Domain Number - Region: 609-668
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000429
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007451   Gene: ENSAPLG00000007802   Transcript: ENSAPLT00000008113
Sequence length 1572
Comment pep:novel scaffold:BGI_duck_1.0:KB742712.1:303276:355123:-1 gene:ENSAPLG00000007802 transcript:ENSAPLT00000008113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQCFIREVLGDGVPPKVAEVIYCSFGGMSKGLHFNNLIVGLVLLTRGREEEKAKYIFS
LFSNESGSYVVREEMEKMLQVVDGKVPESLKKCFSEGEKVNYEKFRVWLLHNKDAFTFSR
WLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFA
PLVSPPIHPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDIDRD
GVLSRTELKEMVVALLEVWKDNRTDKIPELDMDLSEIVEDILKVHDNTKLGHLTLEDYQI
WSVKSALANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFLIAM
PWWHQWKEYVKYDANPVVIEPSSVLSGGKNSLIAAAANTSEQGEDKMGGLNYFSATEEKF
SDNISTASEASETTSSNALYPGTPGTDVCFARQHNTSDNNNQCFLGTNGNSLLQLNPQKP
GAIDNQPLVTQEPVKKAASLTMEGGRLKRSPQLIEGKDYIMVPEPVWRALYHWYGANLSL
PRPVIKNSKTNVPELELFPRYLLFLRQQPATRTQQSNIWVNMVANPGNVPSPNAPLKRVL
AYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQ
HLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQ
PLTRYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNIAPLKLRWTIAKYAP
RFNGFQQQDSQELLAFLLDGLHEDLNRVHDKPYVELKDSDGRPDWEVAAEAWENHLRRNR
SIVVDLFHGQLKSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRY
GLRLNMDEKYTGLKKQLSELCGLKPEQILLAEVHSSNIKGCAQGSSLKITVYSFYLCFHV
WIVNTSIILCSCISTDTSTGSSTNGAPNIMMNGDLPKPTLIPNGMPNTVVPCGTERNLAN
WTLNGHVPLISDSPCTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKD
LYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCR
GCKIECTEDRASVGNAYIAVDWDPTALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDS
CLRAFTSEEELGEDEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQK
IVKFPRENFDPSAFLVQRDPSHFQRKQLTPQLDDLPEPRTPLQGESKKVDLQITYTAEGD
ALNRSPSSLNTTNVLNNIKASPSLGRKSGTSCPSSKNSSPNSSPRTLGRGKGRLRLPQLG
KNKLSSSKENLDASKENGTDQEQKFTSDRSDALTRGQILGGSQSELYTAQDNEMTLANGY
ICEQNAYSNGSINGQIDNHSEDDITDDQREDVCVNPIYNLYAISCHSGIMGGGHYVTYAK
NPNNKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGVDYAQFLPKIDGKKMADTSSMDED
FESDYKKYCVLQ
Download sequence
Identical sequences U3IJM9
ENSAPLP00000007451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]