SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007651 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007651
Domain Number 1 Region: 758-847
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.95e-25
Family DEP domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007651   Gene: ENSAPLG00000008000   Transcript: ENSAPLT00000008315
Sequence length 856
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743108.1:192056:212885:1 gene:ENSAPLG00000008000 transcript:ENSAPLT00000008315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYSNFSAENLSSSANMSIALPGQVGLNTTSGPPSMSISRLFPALLECFGIILCGYIAG
RANIITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVNWSFLYSILVAKAAVFFLVCVL
TLLVASPENRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMML
NPLGFIFCEIQKWRDNRTVAHSKFKIVGLALLRVLQNPIVFMVFIGIISNFILGQKIPEY
LENFLDGLGSSFSGSALFYLGLTMVGQTKKLTKGMFVALILLITAKLLLMPFLCREMVEL
LDKSDSVVNHTSLSNYAFLYGVFPAAPGVAIFAAQFNMEVGIITSGMVISTFVSAPIMYV
SAWLLTIPSMDPNPLASALQNVSFDISIVSLVSLIWSLIVVLLSKKYKQLPHMITTNLLV
AQFIACIGMVIWNFIVKEKDITLQILVFIFLYSSLYSTYLWTGFLSFSLFLLRKRETVKI
PIGFIIIAGWGIPTLLVGILLIVGEHNSTSIDSAFFYGKQQIITTAVILFISILMSGISL
MCMNRNRQESNYEVLNPYSPRSQAEEVEVEGNAGNQVSATVPQPSAGSSAQPSVASSAQP
SPERGCCSCQTTNGELPCAKESKAVPNAVESKVPSIETADQCVSHCSARTCVLAQEEQLL
QTGDKQLARHVLLCLLLVVGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISF
GIFGLDKHLIILPFKRRLEFLLGGREAAEHTDPTLPEEIRMTCQQFVRYHRDHCVKTIVK
GRRCGAKISTGIFFGCDLVNWLIQVGLASDRGEAVMYGDRLMKGGVIQHITNEFEFRDEY
LYYRFIPKRSTTVESQ
Download sequence
Identical sequences U3IK79
XP_005019757.1.99704 ENSAPLP00000007651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]