SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007679 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007679
Domain Number 1 Region: 275-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000218
Further Details:      
 
Domain Number 2 Region: 81-205
Classification Level Classification E-value
Superfamily PH domain-like 2.69e-21
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007679   Gene: ENSAPLG00000008021   Transcript: ENSAPLT00000008343
Sequence length 475
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742571.1:648149:962474:-1 gene:ENSAPLG00000008021 transcript:ENSAPLT00000008343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSTTSDTASEKPSPSHSTGAVQMRIKNANSHHDRLSQSKSMILSENVKVAEPVNRHRR
NHSQHNLTLADIISTQDHTVVEKEGYLLKAKIADGGKKLRKNWSTSWIVLTARKMEFYKE
SKQPALANLKPGYKPECVDLCGAQIEWTPEKSSRKNVFQITTVSGNEFLLQSDIDFLILD
WFHAIKNAIDRLPKERSCTSRNLEFKLKRSSSIELLNSLDTESKEPKPEHRKSLIFRLNY
SASDSNDRNRVKSRLKKFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRL
CIKAVERRGLEVDGIYRVSGNLATIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYCFFEQFVEAIKIPDNASRIKAIRTLVKKLPRPNYDTMKILFEHLKKIAAKE
SVNLMSTQSLGIVFGPTLLRPEKETGNMAVHMLYQNQIVELMLSEYSKIFVSEED
Download sequence
Identical sequences U3IKA7
ENSAPLP00000007679 XP_005011953.1.99704 XP_005011954.1.99704 XP_005011955.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]