SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007693 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007693
Domain Number 1 Region: 32-198
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007693   Gene: ENSAPLG00000008059   Transcript: ENSAPLT00000008357
Sequence length 199
Comment pep:novel scaffold:BGI_duck_1.0:KB742802.1:46175:202785:-1 gene:ENSAPLG00000008059 transcript:ENSAPLT00000008357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPDASLSLCKSLSSVQVRHTTNKVSPDPQIDRERRTFGVPLEALIQDATQCGVPFLVTQM
VEYLEVFGLQHVGIFRISGSVNKVKELKQKYNQGEKVDLINHGDVDSVASLLKLFLKELP
VAVFPDNVCGGLLKTFQEHKIHTTECIKNLRQLLSCLPEAHQNLLQFLSAFLLKIATYSA
VNFMTLENLAVVFGPALFK
Download sequence
Identical sequences U3IKC1
ENSAPLP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]