SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007698 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007698
Domain Number 1 Region: 157-280
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-27
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 55-159
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-25
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000847
Family First domain of FERM 0.002
Further Details:      
 
Domain Number 4 Region: 355-404
Classification Level Classification E-value
Superfamily RING/U-box 0.00000624
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007698   Gene: ENSAPLG00000008040   Transcript: ENSAPLT00000008362
Sequence length 419
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742889.1:55949:69352:-1 gene:ENSAPLG00000008040 transcript:ENSAPLT00000008362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVCRRLGIIEVDYFGLQFTGSKGENLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLIL
QEQTRHMFFLHIKEDLLAGNLQCSSEHAIELSALLAQMKFGDYNQNTAKYNYEELCAKEL
TTTILESNSIIAKHKQLEGLSQASAEYQILQIATTLENYGVEWHSVRDSEGQKLLIGVGP
EGISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSVVLLFKMISTRAASGLYR
AITETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHA
RRALYNAGIVDLVSRSDQTPPSSPLKSSESSMNCDNCEGLSCQQTKALQEKLRKLKESML
CMVCCEEEINSTFCPCGHTVCCKTCAAQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences U3IKC6
ENSAPLP00000007698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]