SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007765 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007765
Domain Number 1 Region: 2-164,191-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.31e-63
Family FCH domain 0.0018
Further Details:      
 
Domain Number 2 Region: 464-649
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000799
Further Details:      
 
Domain Number 3 Region: 701-761
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007765   Gene: ENSAPLG00000008005   Transcript: ENSAPLT00000008430
Sequence length 1042
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743213.1:245408:318862:1 gene:ENSAPLG00000008005 transcript:ENSAPLT00000008430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKSEIEMEYSRNLEKLAERFMAKTRSTK
DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKK
SKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGRSGDPVFH
IRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDL
SDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDSLEPRSDKQRFMEMY
PTAFCPPMKFEFQSHMGDEVCQVTAQQPVQAELMLRYQQLQSRLATLKIENEEVKKTTEA
TLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLSKPSIAKRRANQQETEQFYFMK
FREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTSRGRRNSHTRHQDSGQVIPLIVES
CIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFR
GLENPVFPKERFNDLISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYS
DENMMDPYNLAICFGPTLMPVPDIQDQVSCQAHVNEIIKTIIIHHEAIFPDAKELDGPVY
EKCMAGDDYCDSPYSEHGTLEEVDQDASTEPHTSEDECEPIEAIAKFDYVGRSARELSFK
KGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPITE
DKSSSKDMNSPTDRHSDVYLGRQRKRSEPPPPLRRPGRSSDGHCPVHPPHPLSNSSVELG
SPNLATHCSPRALLQNRNLNADSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQ
YTGFNDHKPLDPESIAQDIEETMNTALNELRELERQSSAKHAPDVVLDTLEQMKNSPTPA
TSTESLSPLHSVVLRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPIVLP
KTNPSIGPSPPSQGPADKSCTM
Download sequence
Identical sequences U3IKJ3
ENSAPLP00000007765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]