SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007785 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007785
Domain Number 1 Region: 332-403
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.04e-19
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007785   Gene: ENSAPLG00000008148   Transcript: ENSAPLT00000008450
Sequence length 462
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743103.1:71823:77811:1 gene:ENSAPLG00000008148 transcript:ENSAPLT00000008450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMAVNPPLMGTGQQRMQTISSQFEPRLVDRDLLPSTEMMASADPRQIHIASHLGPTVPQH
TNMPNILSNRVYPGPGYSFLQPESMEAVARRQELVQKQNIARMEMEMSALFQQKEMEKAH
RKGLLGLEAPFLYHGMPASPIAFRGRHRLPEGHLPGDLYVHRTTLDEIHGNTMLMAASPY
PPVGALQRERGRRPGRRAGNPKSADCGANGTKSQAEDKTADLASTAVDDEKEDKKEAEVE
TPNKHEQSKNQTEPSAVAKNCKEFEQDLRKNCAAHEISAESNSCSNTNEKESNSSCAAFD
DKYIVLKTLRLSFFLTGAHGLILNGEDISTIEDIRKWTVDDVYNFIGSLPGCSDYAQIFK
DHAIDGETLPLLSEEHLLDTMGLKLGPALKIRSQVSRRLGNVLYMMNLPLSVPLPSAPGK
PSDQPSDIASPLHCNSSGDALDSPCSQGPEASKTVEQIVSES
Download sequence
Identical sequences U3IKL3
ENSAPLP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]