SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007823 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007823
Domain Number 1 Region: 91-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.83e-31
Family DEP domain 0.0034
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-29
Family DEP domain 0.0012
Further Details:      
 
Domain Number 3 Region: 281-365
Classification Level Classification E-value
Superfamily PDZ domain-like 7.32e-16
Family PDZ domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007823   Gene: ENSAPLG00000008162   Transcript: ENSAPLT00000008488
Sequence length 369
Comment pep:novel scaffold:BGI_duck_1.0:KB743558.1:287919:333989:1 gene:ENSAPLG00000008162 transcript:ENSAPLT00000008488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIDHKEASDRETAIKLVQKLLDHSIIHH
VCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKVFMRGQRLYEKLMSSENTLLQAREEEGVK
YERTFVASEFIDWLIQEGEATTRTEAEQLGRRLLEHGIIQHVSNKHHFMDSNLLYQCRMN
FRRRRRLMELLTEKSRLMPESHDSPFCLRKQNHDNRKHTSFLSVSPTKEIKIVSAVRRSS
MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTADELLMPGAPYVRKTFTIVGDAVGW
GFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIV
MEVMEEIES
Download sequence
Identical sequences A0A091S1L2 A0A093FTZ9 A0A094L3Z7 R0JLU6
ENSAPLP00000007823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]