SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007891 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007891
Domain Number 1 Region: 61-195
Classification Level Classification E-value
Superfamily BAG domain 1.57e-51
Family BAG domain 0.00000434
Further Details:      
 
Domain Number 2 Region: 3-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000143
Family Ubiquitin-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007891   Gene: ENSAPLG00000008224   Transcript: ENSAPLT00000008557
Sequence length 195
Comment pep:novel scaffold:BGI_duck_1.0:KB743685.1:147848:159742:1 gene:ENSAPLG00000008224 transcript:ENSAPLT00000008557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNEKHSIQVASPQEDSEPTLQDMALLIEQVTGVPVPFQKLIYKGKSLKELEQPLSALGVK
NGCKVMLIGKRNSPEEEAELKKLKDLEKSVEQIANKLEEVNKEFTSIQKGFLAKDLQAEA
LKQLDKRIKGTAEQFMKILEQIDAINLPENFSDCKLKKKGLVKRVQAFLAQCDTIEGNIG
QEMDKLQSKNLALVE
Download sequence
Identical sequences R0JKB8
ENSAPLP00000007891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]