SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007963 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007963
Domain Number 1 Region: 682-1036
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.16e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 506-678
Classification Level Classification E-value
Superfamily ARM repeat 2.93e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000351
Further Details:      
 
Domain Number 3 Region: 106-285
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-47
Family Ras-binding domain, RBD 0.0048
Further Details:      
 
Domain Number 4 Region: 327-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.76e-47
Family PLC-like (P variant) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007963   Gene: ENSAPLG00000008183   Transcript: ENSAPLT00000008631
Sequence length 1047
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742794.1:82414:103591:-1 gene:ENSAPLG00000008183 transcript:ENSAPLT00000008631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVSCNASLGTIKQVVWKHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSMQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGFGT
GLLHTPTKNIFVNVKFQSGGESFTFQIAPDEFPITLMSYAIKKQATVFRHETMESPEDYT
LQVNGKYEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQINCIANTPKMS
AKPPPLPKKKPNYGSLWSLEQPFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVNVCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAASLVICFPNVAS
HPVYYPSFEQLLELGRNGEPTRTAPEDPEEQKLQLKEILERRSHTELYEHEKDLVWKMRY
DIRDQYPQALAKLLIITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFA
INSLKKLTDNELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMH
VPAVALRFGLILEAYCRGSTHHIKVLMKQGEALNKMKALNDFVKVSSQKATKPQTKEMMH
VCMKQETYLEALSHLQSPLNPSIILAEVCVDQCTFMDSKMKPLWIVFNNEETAGGGVGII
FKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANI
QLNKSNMVATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFR
GYCEKAYMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRL
KFNEALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences U3IL41
ENSAPLP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]