SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007967 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007967
Domain Number 1 Region: 45-101,223-361,401-447
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.11e-75
Family Inositol polyphosphate kinase (IPK) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007967   Gene: ENSAPLG00000008308   Transcript: ENSAPLT00000008635
Sequence length 450
Comment pep:novel scaffold:BGI_duck_1.0:KB744329.1:56441:64033:-1 gene:ENSAPLG00000008308 transcript:ENSAPLT00000008635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPCGSPHAPSVQLVPNAMCVCQTMEVGKHGKNATRSGDRGVLLEPFIHQVGGHSSMMRYD
DHTVCKPLITREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVENEALE
QDDMPERDQPRRKHSRRSLHRSSSGTEHKEEKPGLASDSTESNIQETKSPRVDMHIHSDV
PFQMLDGNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKFPCV
LDLKMGTRQHGDDASEEKAARQMKKCEQSTSATLGVRVCGMQVYQLNTGHYLCRNKYYGR
GLSIEGFRNAIYHYLHNGVELRKDLFEPVLAKLRSLKAVLERQASYRFYSSSLLIIYDGK
DNRSGTFVDIRPEARLKRTDSSLPESLQDGGSTEPDSPRPKVDVRMIDFAHSTFKGFRDD
PTVHDGPDMGYVFGLESLINIMEQMREENQ
Download sequence
Identical sequences R0L515
ENSAPLP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]