SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008016 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008016
Domain Number 1 Region: 60-135
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000254
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008016
Domain Number - Region: 10-50
Classification Level Classification E-value
Superfamily Tropomyosin 0.0262
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008016   Gene: ENSAPLG00000008352   Transcript: ENSAPLT00000008686
Sequence length 515
Comment pep:novel scaffold:BGI_duck_1.0:KB743108.1:673697:704942:-1 gene:ENSAPLG00000008352 transcript:ENSAPLT00000008686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNKLSLCRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFDI
CAWTEEDVFLWMQQLTRKGDASGEMSVYARLFKEHHITGKRLLLLEEEDLKDMGIVARGH
IIHLKTAIEKLTHDYLNLFHFPPLIKDSAGDAEENIEKVVNLELVFGYHLKPGNGPKDCK
WKMYMEMDGDEIAITYIKDVTFNTNLPDVEILKMTKPPFVMEKWIVGMEEHQSVEYVVTY
ESDVRAPKTTRHVQAIHWSKVKVQDEVEAVQLIIQTSLPNSEGHSRSRSDSSIDSQWMKT
LRMHQLAKATSLQHGHPHSPTSMTQYLPYLRSQDSYAAAVRRTRGPVSYQFTSISHSRNS
SPLSHSLMRNLSNLHLNSKGSSTSSTASDTASERDRSTGKARNASHSGNSRSSSDGRHSG
TSSPVPPRTSGRAYRTSSTPPAPEHRRYSRNPPWPKAIPGMPLQGESEPRRGEGEGRVSE
GGWIKVQNTRKPYRQSTGKPGRERPRGSWRGRRTF
Download sequence
Identical sequences U3IL94
ENSAPLP00000008016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]