SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008022 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008022
Domain Number 1 Region: 1-208,280-308
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.28e-51
Family Creatinase/aminopeptidase 0.00031
Further Details:      
 
Domain Number 2 Region: 205-281
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000571
Family Methionine aminopeptidase, insert domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008022   Gene: ENSAPLG00000008321   Transcript: ENSAPLT00000008692
Sequence length 364
Comment pep:novel scaffold:BGI_duck_1.0:KB749505.1:1689:11007:1 gene:ENSAPLG00000008321 transcript:ENSAPLT00000008692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRAVVEAASSGASVLCLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFS
PLKSDQDYILKDGDLVKIDLGVHVDGFIANVAHSFVIDASKENPVSGRKADVIKAAHLCA
EAALRLVKPGNQNTQVTDTWNKIAHSFHCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK
KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVE
RRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGP
MRITSGPFEPELYKSEFEVQDGELKALLQSSASRKTQKKKKKKASKNAENATTGETAEEN
EAGD
Download sequence
Identical sequences U3ILA0
ENSAPLP00000008022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]