SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008027 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008027
Domain Number 1 Region: 922-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.41e-17
Family SAM (sterile alpha motif) domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008027   Gene: ENSAPLG00000008376   Transcript: ENSAPLT00000008697
Sequence length 991
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743103.1:126328:150871:-1 gene:ENSAPLG00000008376 transcript:ENSAPLT00000008697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDEHCTAMENEPNTTTCSASTTTITTTSTSRTPLPQISVYSGSDRHAVQVIQQALHRPPS
SAAQYLQQMYAAQQQHLMLQTAALQQQHLSSTQFQSLATVPQASLSGGRQCTSPPGSVTQ
QSSMSQTSINLSTSPTPAQIISRSQTSNTTSSSITQQTMLLGSTSPTLSASQAQMYLRAQ
MLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSSS
QTQSLSLCANKPVSSTKGSQPDPSESNRKGDSPTPECRSTPVTRTSSIHQLITPASYSPL
QPHSLVKHQQIPLHSPPPKISHHQLILQQQQQVQPIALQTPSGQEPPPSQHCLPLPSHGL
PPAPSSVQSHCSPIHIHPPPLTLSPTPSQSAQQSVVVSPPPSHSPSQSPTIIIHPQALIQ
SQANSLVPTALQPEQGAAQQTATNPVRPIAQPLNLPPHLPLPPSPAVHIGSVDPPSLVSS
GQQIVSSTPHQQYSALQSTPIPLAAPPQLSTSSTQIQQLPLQSVQSLQVQPEILSQGQVL
VQNTLVSEEELPAAEALVQLPFQTLPPPQTVAVNLQVQPSVPIETPVIYQVENVCEEEMP
EESDCVNMVRTPTPPTLSPPAITLGNGEALNSEEPLSDHVGIPSVTSSVSASVIKSPSDP
SHASIPPPPLLLPAATTRSNSTSMPNSIPSLENKPPQAIVKPQILTHVIEGFVIQEGLEP
FPVSRSSLLVEQPAEKRLLVEGQIMSVMCVESDLQNTKHADNSSDTEIEDMIAEEGLDEI
ENDLLKCEFCGKMGYSNKFLRSKRFCSTSCAKRHSLSCTKKFGLFTSDKTNRWNRKSDSQ
SLGRRGRRPSGPDGASRDHFLRQLPVTYPSAEEDLASHEDAVPAAMTTRLRRQSERERER
ELRELRIRKMPESIDLLPVVQADPSVWTVDEVWAFIHSLPGCQDIADEFRAQEIDGQALL
LLKEDHLMSAMNIKLGPALKICARINSLKES
Download sequence
Identical sequences U3ILA5
ENSAPLP00000008027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]