SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008055 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008055
Domain Number 1 Region: 589-687,713-801
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000978
Further Details:      
 
Domain Number 2 Region: 99-378
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-48
Family FCH domain 0.0053
Further Details:      
 
Domain Number 3 Region: 521-571
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008055   Gene: ENSAPLG00000008349   Transcript: ENSAPLT00000008725
Sequence length 805
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744754.1:104432:114270:-1 gene:ENSAPLG00000008349 transcript:ENSAPLT00000008725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISKVKGFHYESNNETDKREFEKAVETPLPEPSPLVSEFLMGEVDSSLLSIPPSDQNQSM
ESLYSGISGGVVMPAGTESYDTVRPAAEEVDVMLQRCEGGVDAALQYAKNISKYMKDLIG
YLEKRTTLEMEFAKGLQKMANSCKQTITQETSMPFLSIYLLALEQDMEYGTSVLQTVNTL
QHQTFLQPLTVRRLEHEKRRKEIKEQWHRAQRKLQDAEVNLRKAKQIYMQRSEEHDKAKY
MAAKAEEEQQSTTSGITTKALDKKRRLEEEAKNKAEEAMATYRTCIADANTQKQELEDTK
VNSLRQIHELIKQSDQVIKLATIAFYQIMHMQTAPLPVYFQTLCESSKLYDPGQQYASHV
KQLQRGDEPDTQYDFEPYVSHNAWSPFIRSRKGSFNANDFSTSSSPDGAGMPKDGAPSEG
GAGAKEQQSGAGAERRGGRGHQVHKSWPTSTSETDSSLDSNTGSIKTEQRLSSNGTMSSS
EELEEKDENAASFEQSINGITPEMTAPTGPFRNVGLSKAAQTHRLRKLRAPSKCRECNSY
VYFQGAECEECYLACHKKCLETLAIQCGHKKLQGKLQLFGQDFMKASQSSSDGIPFIIKK
CISEIEKRALKTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL
PEPIMPFRMYNELMGLAKESLQGGSEAKGRSGKGGPELVDRGADTDKVVVTLVLKLKELL
KELPWENMATLQYLLQHLRRIVEVEQDNKMTSSNLGIVFGPTLMRPRPTDATISLSSLVD
YPHQARIIEALIIFYSTIFENKEAP
Download sequence
Identical sequences U3ILD3
ENSAPLP00000008055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]