SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008062 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008062
Domain Number 1 Region: 9-363
Classification Level Classification E-value
Superfamily Cullin repeat-like 4.19e-116
Family Cullin repeat 0.00000203
Further Details:      
 
Domain Number 2 Region: 355-653
Classification Level Classification E-value
Superfamily Cullin homology domain 1.96e-95
Family Cullin homology domain 0.00000027
Further Details:      
 
Domain Number 3 Region: 658-746
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-29
Family SCF ubiquitin ligase complex WHB domain 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008062   Gene: ENSAPLG00000008361   Transcript: ENSAPLT00000008732
Sequence length 746
Comment pep:novel scaffold:BGI_duck_1.0:KB743977.1:315004:353258:1 gene:ENSAPLG00000008361 transcript:ENSAPLT00000008732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVT
EHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNL
GLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYE
EDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVK
VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSSYLR
EQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFNNDRLFKQTIAGDFEYFLNLNS
RSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLT
NKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQTTGVSLGGVD
LTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNAT
FYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDI
PERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQG
ESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIK
KRIEGLIEREYLARTPEDRKVYTYVA
Download sequence
Identical sequences R0KT43
ENSACAP00000004180 XP_012961377.1.99704 XP_012961378.1.99704 XP_013036981.1.65836 ENSAPLP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]