SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008076 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008076
Domain Number 1 Region: 113-174
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.1e-23
Family Transcriptional factor domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008076
Domain Number - Region: 19-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0354
Family ArsR-like transcriptional regulators 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008076   Gene: ENSAPLG00000008425   Transcript: ENSAPLT00000008747
Sequence length 421
Comment pep:novel scaffold:BGI_duck_1.0:KB743301.1:2995993:2999407:1 gene:ENSAPLG00000008425 transcript:ENSAPLT00000008747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQSVITEVPAALKRLAKYMVRGFYGVEYSLALDVLIRHPCVKEDDLLELLKYERKQLR
TVLNTLKADKFVKLRMRVETGPNGKSTRHNYYYINYKVLVDVIKYKLDHIRRKIEADERD
STTRSSFKCPSCSSTYTDLEVNQLFDVFTETFRCTYCNTEVEEDASALPKRDARTLLAKF
NEQIEPIFALLRETEDIVLPYDLLEPQPTEIPELSESFDQKTCSSMLETCGRPEKWATRS
SSFGNIYTQNLVIDVQDSEPKKNKREKATKEQPVWMSQSTVEGATTVTNNIAGVSASEET
EESNKETIPENEIIKTLLIHESKSLSGTDHAPVVKSKLPESGSDTSESEDAKHSGTALTK
VGGSNFEEEEQEALNPVLMVAGQPYSYSEVSENPELVSLMTNEEREAYIKVGQEMFQSVF
E
Download sequence
Identical sequences R0LH27
XP_012957280.1.99704 XP_012957281.1.99704 ENSAPLP00000008076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]