SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008131 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008131
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily CutC-like 5.36e-54
Family CutC-like 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008131   Gene: ENSAPLG00000008461   Transcript: ENSAPLT00000008803
Sequence length 200
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742660.1:197596:201639:1 gene:ENSAPLG00000008461 transcript:ENSAPLT00000008803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRVPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLHGADGLVFGALTEYDAVLRLTMCLL
IAAACRPLPVTFHRAFDMVHDPQVALETLISLGFERVLTSGCDSSALEGLSLIKKLAEQA
KGRIVVVPGGGITERNLQRILEGSTVSEFHCSARSARDSGMKFRNPNVAMGASFSAPEYS
IKVADVAKVRTLNAIAKNIL
Download sequence
Identical sequences U3ILK9
ENSAPLP00000008131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]