SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008155 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008155
Domain Number 1 Region: 9-298
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-57
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008155
Domain Number - Region: 306-359
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00141
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008155   Gene: ENSAPLG00000008445   Transcript: ENSAPLT00000008827
Sequence length 729
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744799.1:49079:71477:1 gene:ENSAPLG00000008445 transcript:ENSAPLT00000008827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTSNYLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNSISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTSRHKVLVMEFCPCGSLYTVLEEPSNAFGLPESEFLIVLRDVV
AGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKEHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGIQKAENGPIEWSWEMPVSCSLSKGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRIIIHIFSLQLMTLHKVYIHSYNTAAIFHELVYKQTKIPSQNQELIYEGRRLI
LEPGRLAQHFPRTTEENPIFVVSREPVNIVGLIYEEVLLPKVHQRYDLDGDASMAKSVTG
IVCYACRVASSLLLYQELMRKGIRWLIEIIKDDYNELVHKKTEVVIRLDFCSRNIEKAEK
IYENLMQINLESSEVDEISEINTKLLRLSSSQGTIETSLQDIKNKLSPGGLLADTWANQE
GMHPRDRNPERLQALLCSITDIYYQFKKDKAERRLPYNEEQIHKFDKQKLYLHATKAIAL
FKEECVSKYEVFLDKSEDWTRKMLHVRKQLLALTNQCFDIEEEVSKYQDYINELQDALPQ
KMFAASSGMKHTMNTVYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGALTTD
GGLRNVDCI
Download sequence
Identical sequences U3ILN3
ENSAPLP00000008155 XP_005029507.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]