SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008156 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008156
Domain Number 1 Region: 210-406
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008156   Gene: ENSAPLG00000008489   Transcript: ENSAPLT00000008828
Sequence length 789
Comment pep:novel scaffold:BGI_duck_1.0:KB742810.1:1705552:1764163:-1 gene:ENSAPLG00000008489 transcript:ENSAPLT00000008828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDFTWNSMSGRSVRLKSVPVQSLSELERARLQEVAFYQLQQDYDLGCQIAIPKDGQKRKK
SLRKKLDSLGKEKNRDKEFIPQAFGMPLSQVIANDRAYKLKQDSQREEQKDVSDFVAFLL
PFGTKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRGAMSVDSITDLDDNQSR
LLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQHLEKHGLQTVGIFRVGS
SKKRVRQLREEFDRGIDVVLDEEHSIHDVAALLKEFLRDMPDPLLTRELYTPFINTLLLE
PDEQLSTLQLLIYLLPPCNCDTLHRLLQFLSTVAGHAEDTTDKDGQEITGNKMTSLNLAT
IFGPNLLHKQKSTDKEFTVQSSARAEESTAIIAVVQKMIENYEALFMVSPDLQNEVLISL
LETDPDVVDYLLRRKASQSSSPEMLRSEGSYSTGERHSSTDSNKASSGDVSPYDNNSPVL
SERSLMATQEEVARSPDKLYRVPEQYTLVGHLQPKTKENSSASQAGKDVSEDHFDIWGTW
HSTLKSGCKDTGITGSYGNIYESSLLRPGQCSLSQGNLSIYSPRWQGSSSELDSSRQVMR
RSQTTAAIPECQLHPAPSRVCSNPHIEASSRSLDQSRSKSERHLTLSSVEDLTEYDLHAG
CSQSTAKPSYRKERPPPPYPGPAKTSSALSQRSGVSSTLHSLWRLQRQEKSSGTRAAGGP
AAKAPEQAISRQERSAPHTQVGNIYSTAAHNQNSKNVSEPDWHDWQRERWQIWELLSADN
PDALPETLV
Download sequence
Identical sequences R0LUF6
ENSAPLP00000008156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]