SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008168 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008168
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000861
Family Ras-binding domain, RBD 0.055
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008168
Domain Number - Region: 100-120
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0638
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008168   Gene: ENSAPLG00000008513   Transcript: ENSAPLT00000008840
Sequence length 128
Comment pep:novel scaffold:BGI_duck_1.0:KB742437.1:1938:2755:-1 gene:ENSAPLG00000008513 transcript:ENSAPLT00000008840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRHIEHFALVLEYS
SPEQSHRFLLLQDKQPLAHVVQRTHYHGMRCLFRVSFFPKDPVELLRRDPAAFEYLYIQV
GTGQPPRR
Download sequence
Identical sequences U3ILP6
ENSAPLP00000008168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]