SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008255 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008255
Domain Number 1 Region: 623-830
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000661
Further Details:      
 
Domain Number 2 Region: 137-407
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-37
Family FCH domain 0.019
Further Details:      
 
Domain Number 3 Region: 548-603
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008255   Gene: ENSAPLG00000008546   Transcript: ENSAPLT00000008930
Sequence length 1207
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743021.1:5033:57586:-1 gene:ENSAPLG00000008546 transcript:ENSAPLT00000008930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLHQVVHEHLGELLRVLKAVINKHQTLNSVDILSAAGTVIAKVKEAVNFKEVNEENKRE
LFSEIFASIETLAFTFGNVVSDFLMGDVDNGSSLGLPVSRRSQSFENLSVESGGSLHERD
DIQAEEVDNMLLRNDSGIESALSYAKAWSKYTKDVVAWVEKKLSLEVECAKNLAKMAETA
KAVVGPQDYMPFQSIFLNAFQNDIENNQLWQQTAAALQSNKFVQPLLGRKNELDRQRKDI
KELWQREQKKMQELEAALRKAKSLYTQRQDEYEKAKSCTARAEEEHLSSSGSFVKDFSKQ
LEKKRRLEEEALQKAEEANEHYKASIAEIKEKRNDLESFKSDVLMQLRELIFQCDLTLKA
ATVNLFQLQHAQVVSLPVNCQSLCESAKLYDPGQQYSEFVKISKSTREQSTNSVHTSHGN
LSQCSGDFPSQMLDDVGSPIYHRSQRIGEKRSSSSTDIQAIRGPPPFRSWSVGNQSGGMC
SDSESAGGSSESRSMDSPSASPGDFKRRLPRTPSTGTMSSADDLDEREPPSPSDCAANSP
GPFRNTSMSKAAQTHKLRKLRAPSKCRECDSLVVFHGAECEECSLACHKKCLETLAIQCG
HKKLHGRLHLFGVEFAQAAKNAPDGIPFIIKKCTSEIESRALNVKGIYRVNGAKSRVEKL
CQAFENGKDLVELSELYAHDISNVLKLYLRQLPEPLILFRLYNEFIGLAKESQSVNEELD
AKQASPKSKKRQSICIELNRIIIKIKDLLKQLPVPNYNTLQYLIGHLHRVTEQSDENKMS
ASNLGIIFGPTLIRPRQTDATVSLSSLVDYPYQARIVELLITYYEKIFDVSLQPLLSTSQ
SEEAAITVRVALSGGEREPQQQRKSFVAVKEGILIAPSENRASEAAVLFLESNNSKNTKE
QVDTSATGDAVSPASEKDNDSFVSPGEDGCKINLLPAKPNRQINKVPLRVPRTKLAIRPV
SLPVDRILPPCVLNERNTKNAGAVSPENLGKSPTIEEVSEVKALSAVSTCCRLSCCDTQM
LRKTWDKQYKQYDITARTAMIVTNVPQENRALESGTAGALSSSCSMGNNSANAGLHVKPY
SLSVRSGRTAAEGSGPDAKSVATFRASRTLQPPPGTFYKPPSNKSKQNEESSTTKACAST
STSSVLHQDNTVKLARSSVPLSGDPGQNTDEQKTSSEDAHPTDLKPTYQRLRPKRIQELE
HREAHFV
Download sequence
Identical sequences U3ILY3
ENSAPLP00000008255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]