SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008264 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008264
Domain Number 1 Region: 153-247
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 5.62e-25
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 319-407
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000328
Family UBX domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008264
Domain Number - Region: 15-86
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008264   Gene: ENSAPLG00000008598   Transcript: ENSAPLT00000008939
Sequence length 419
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743160.1:20498:30228:-1 gene:ENSAPLG00000008598 transcript:ENSAPLT00000008939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGAAPTDMDLTSSIMQKISLLEQKIDKQAREIQLKDRRIAELEEKMKTLQKGEDAPDSS
TAEDLEMRCLQLQTQVWEMERFLNDYGLIWVGERHEQLEDLQSLKDEELPAKSLWKPGEA
VVSKHEIDFDLILENVKDLNMLAGEGISQIEHTPQGARLRQQEPLPLTLYQNGIVMFDGP
FRSYEEPSTQQCLQDIMDGYFPSELQMRYPDGIPFQVTDKRDVVFQEGDLPGSFPGHGQA
VGHSESSKVQETDEIPALAGPKPSSKQFLNNLSESSAPGGEAINIQDSVGARQQGSGGTW
SSREIVVETPRLSALKRLKTTEEAGAPAPEVCTLRIKSESREQTYIVRMLFSETIGDLRQ
HLARARGGDSGSYEILSTFPQRVYADNARSLQECGLIPSASLLLRRRDPLPPQRPGFSP
Download sequence
Identical sequences U3ILZ2
ENSAPLP00000008264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]