SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008290 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008290
Domain Number 1 Region: 25-488
Classification Level Classification E-value
Superfamily Sema domain 6.28e-122
Family Sema domain 0.0000568
Further Details:      
 
Domain Number 2 Region: 1601-1728,1917-2103
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-45
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1068-1162
Classification Level Classification E-value
Superfamily E set domains 8.03e-17
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 491-543
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000296
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 1160-1250
Classification Level Classification E-value
Superfamily E set domains 0.000000000000407
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 6 Region: 1250-1294,1323-1375
Classification Level Classification E-value
Superfamily E set domains 0.00000098
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.093
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008290
Domain Number - Region: 645-677
Classification Level Classification E-value
Superfamily Plexin repeat 0.00327
Family Plexin repeat 0.0068
Further Details:      
 
Domain Number - Region: 1391-1443
Classification Level Classification E-value
Superfamily E set domains 0.007
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 1029-1063
Classification Level Classification E-value
Superfamily Plexin repeat 0.0732
Family Plexin repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008290   Gene: ENSAPLG00000008562   Transcript: ENSAPLT00000008965
Sequence length 2136
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743891.1:136963:170629:-1 gene:ENSAPLG00000008562 transcript:ENSAPLT00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGTFFLPVLCFLGAAIPRGLQYVTFSRNATKFLHLSMDLESGSIYLGATNFLFQLTSD
LLMQNVVQTGPVLDSKDCLPPVSRLECPQAHHTDNHNKLLLVNAVQKELIVCGSVHQGIC
EKRSLASIDHVLFRPESPGDTQYVAANDPNITTVGLVAYSKDEVPLLFVGRGYTSRGVGG
GIPPITTRNLRAHGGDVQATDSHSIFSYEETAKLAVGRLSEYNHHFIKSFTYRSSVYFLF
YRRDLKSQSREYKTYISRICLDDSHYYSYVELPLLCQSKANTYSLLQAAYVTRPGKDLAQ
GQLDTDGEVLFAAFSAWQASSGKLSEESALCVYAMEEVDRLTNWTRDVCYMRDGKSEEGT
EVAYIEYDVSSNCVQLPADTLYAYPCGSDHTPSPMASRVPLEAAPLLEKTDARLTAVAVN
VEDGHTIAFLGDSRGRLHKVYLGAMGDAHIYASLPIQLNSVVSGDLLFDQLQENLFVMTQ
SMVVKVPILECSLYLDCESCLALKDPYCGWCVLQGRCSRRSECLRSRLSEQWLWSFNSTQ
QCLSVQSLTPANISREEKRNIFLAISDLPSLHEEEFYSCYFEDYESPAVLTESGIMCPSP
DPSQAPTLPAGADHVTIKLVVRFHDIFIASVDFSFYDCAAVALLWKSAPCQKCVSSPWGC
NWCIQQHLCTHKAACEEGIIIYNERVRPLLSPSGVKQPLAVTEAPLPPPADKPAVTLPDT
TSPAASVLTSPSKNGDHAALPTAEPATAQEPWGTDPPTTAVATPLLTTAPAVTPSPHVTN
FRWPPNSFPTTEAQTSAIPSPQPRSEVPGEPAASDDSPGFLGTEIPASELPPSAPPDWLL
GEDTELQDTEDWMDLLQAENETSPFSASTLLSGDGDSSERDVPDLPRILHPDLDYQYDAP
GFWEENEEFSWGPGACPCVQGIQGSSLFPVNVARKITLLGKNFHLYQDQQWDYECVLNLE
GRIMVMDAYVEREETNQSLCYITCQLNQYSYTAPQLEFNAVVFVQRRRHLRVDSAADLHV
TFYNCSVGHTDCSRCQTADSKYNCVWCGGSNPSCIFRGSCKEEIEDLCPAPLIHSVYPLS
GPVEGGTRITITGSNLGQKHQDIAETVTVAGIPCAVDAQEYEISSSIVCVTGGSWTERFG
HVVVEVPGGGRGVSGHIFTYQNPELKSIVPTQGPKAGGTCLTLLGSKLLTGHPSEISVLL
GDLPCRILSEMTEDQLACQTSPSNVSAELPVTIKYGDQERRLEGFLFRYTLDPNITFAEP
PKSFLSGGRVLRVHGYNLDVVQKPKIRVTVSPSERRRRGVGRWRRIIPDTECPEGALCSV
QQFEEPCLVNSSYLILCKTPAINLLLRSVHIKLEFILDNLSFDFNSLHPMPFSYEVNPIL
KPLNAEDPAKPYRHKPGSVISVEGENLDLAISKDEVMAMIGEGICVVKTLTRNHLYCEPP
SEQPAPRHRTKREGTDLLPEFTVQMGNLNFLLGRVQYDTESQLTFPLEAQIGLGVGASFV
ALVVLVIVFIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDLTSDLVG
TGIPFLDYKSYAERIFFPGHRESPLQRDLDIPECRRQTVEQGLVQLSNLLNSKLFLTKFI
HTLEIQRTFSPRDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYAFVRDSVGEPLYMLFRGIKHQVDKGPVDWVTGKAKYTLNDNRLL
REDLEYRTLTLNALTQAGVAAGGAEDSQGISAKVLDCDTITQVKEKILDQIYKGTPYCHR
PDPDTLDLEWRSGLAGHLILSDEDVTSVVQGTWKRLNTLQHYKVPDGATVALVPRLTKHI
HRENQDYIPGEKTPMLEDADEGGIKLWHLVKPTEEPELPKHRRGSLRDRERAKAIPEIYL
TRLLSMKGTLQKFVDDLFQVILSTNRPVPLAVKYFFDLLDEQAMHYGIADPETIHIWKTN
SLPLRFWINIIKNPQFVFDVQTSDNVDAVLLVIAQTFMDSCTIADHKLGRDSPINKLLYA
RDIPRYKQMVERYYADIRQTISASDQEMNSALAELSRNYSGDLNSLVALHELYKYINKYY
DQIITALEEDPTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences U3IM18
ENSAPLP00000008290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]