SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008325 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008325
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-18
Family PDZ domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 1098-1164
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.71e-16
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008325   Gene: ENSAPLG00000008650   Transcript: ENSAPLT00000009001
Sequence length 1166
Comment pep:novel scaffold:BGI_duck_1.0:KB742830.1:67334:209025:-1 gene:ENSAPLG00000008650 transcript:ENSAPLT00000009001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYIIEEKTAVLQKREHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAG
LRTGDFLIEVNGVNVVKVGHKQVVSLIRQGGNHLVMKVVSVSRKPESEEVVRKKAPPPPK
RAPSTTLTLRSKSMTAELEELGSDVAKISRQAHGDEAGPSPTAEPSLRADIVEADSRAAT
VKQRPTSRRITPAEISSLFERQGMAAHSGVLAGAEKPHVSLRKGIPRTKSVASQTSHSSL
FPEREDEKLAASLLDGKFPRSTSMQDTVREGHGIPPPPQTAPPPPPSPYYFDTGPPPSFS
PPPPPGRAYDTIRSSFKPSLEAKLHGLPQVISAAEMQKRARSMIILQDSSHLPVEPTEIP
RPGPSATPPEKLKRKGRVIDNPYANMGQFNVSLFAPTKPQRKKSPLVKQLQVEDAQERAA
LSITGGFTREPSPTRRSHRLSGVEYQHHTGIAQVEATSIPFATAIAGVMKDRDRRLDEKR
KSTVFLSVGAIEGSPPSSDMPSLQQSRSIDERLLGSRDVLLPSPVSALKPLISSSSSTFI
HPLTGKPLDPNSPLALAALAARERALSTQVPSRSPTPIHSPDSDRAAPLFVDIQTKEPER
GELESLVSPAYSPGGKGAIVRKETEARAETPVKEEKKQEDKKSMIISIVDTSQQKTAGLI
MVHATSNGQDEVGLEVKEEKPAVPEACTEPAESPKAETQPSPVGKPPVSPASDKTLGQGS
SEEEVEPYTVTLPPAQLSSSDEETREELAKIGLVPPPDEFANGVLVTTPGTPVSHLATPS
TPSIPAAAVAPSTTGGTPSGKPSDAPVAPESAADSGVEEVDTRSSSDHHLETTSTISTVS
SMSTLSSESGEPTDTYTSFADGQTFILEKPPVPPKPKLKSQLSKGPVTFRDPLLKQSSDS
ELISQQHAATLASASIGRPRYLFQRRSKLWGDPMESRPIHGADDDKPTVISELSSRLQQL
NKDTRSLGPRAAQGLDNPSGLKRSRSRLRSLGELSTISQRSSGTTYTVRPGSRYPVTRRT
PSPVKPALDRTEPLSTVRPYGLTPPTILKSSSLSIPHEPKEVRFVVRSVSARSRSPSPSP
SPGPPLHTLHPPRPFMQKPLHLWNKYDVGDWLESINLVEHRDKFEDHEIEGTHLPALTKE
DFVELGVTRVGHRMNIERALKQLVDS
Download sequence
Identical sequences U3IM53
ENSAPLP00000008325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]