SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008497 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008497
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000172
Family Ras-binding domain, RBD 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008497   Gene: ENSAPLG00000008816   Transcript: ENSAPLT00000009177
Sequence length 214
Comment pep:novel scaffold:BGI_duck_1.0:KB744799.1:170272:174536:1 gene:ENSAPLG00000008816 transcript:ENSAPLT00000009177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDVQKEREPHVYLSKEEVKEKIQSYNSSVTDKLKMTLNSNGIYTGFIKVQMELCRPITVQ
SSPSQGRCAHSNNETAFCLPNDCVNTLHISSTNTVREVIEALLKKFFVTDNPAKFALYKR
CHKEDQVYTCKLSDREHPLYLRLVAGPRTEMLSFVLREHETGEVMWEAFSLPELQNFLRI
LDKEENEQLQILKKRYAAYRDKLEEALGGVWKPG
Download sequence
Identical sequences R0JAZ7
ENSAPLP00000008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]