SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008633 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008633
Domain Number 1 Region: 660-828
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000701
Further Details:      
 
Domain Number 2 Region: 87-267
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-30
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 3 Region: 309-385,443-477
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-18
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 520-635
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000359
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008633   Gene: ENSAPLG00000008900   Transcript: ENSAPLT00000009315
Sequence length 876
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743446.1:659124:682745:-1 gene:ENSAPLG00000008900 transcript:ENSAPLT00000009315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGGGERQRDLGLLSPAGRRHLRDAHPPSSLPLADFNYGADDYDAEGNEEPKALPEGSET
MPYIDESPTMSPQLSARGQDSGDGVSPTHPPTASAPGGERDAGKGLEMRKLVLSGFLASE
EIYINQLEALLLPMKPLKATATTSQPVLTLQQIETIFYKIQDIYEIHKEFYDSLCPKVQQ
WDSNITMGHLFQKLASQLGVYKAFVDNYKIALETAEKCSQSNYQFQKISELLLPCPLPSC
AAAPRITLMALLYKPIDRVTRSTLVLHHPRDPKWSPEDADLPVLVLAEPRRGTGASGPRG
VLTLALCPFSRHPCSPQTRQLIKDGFLVELSEGSRKLLFLFTDVLLCAKLKKTAVGKHQQ
YDCKWYVPLADLVFPSPEESEHCPQVHVIPDHELEDMKMKISAIKSEVQKEKANKGQSRA
IERLKKKMFENEFWLLLNSPAIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQ
AFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLY
CTLEVDSFGYFVSKAKTRVFRDTTEPQWNEEFEIELEGSQSLRILCYEKCYDKTKLNKDN
NEIVDKIMGKGQIQLDPQAVQTKNWHMDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTG
VFGVKISVVTKRERSKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNK
DILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRS
LPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEGESKGHLTLASDIW
SHDVMAQVQVLLYYLQHPPISFTELKRNTLYFSTDV
Download sequence
Identical sequences U3IN10
ENSAPLP00000008633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]