SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008742 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008742
Domain Number 1 Region: 113-203
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-34
Family Forkhead DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008742   Gene: ENSAPLG00000009060   Transcript: ENSAPLT00000009427
Sequence length 489
Comment pep:novel scaffold:BGI_duck_1.0:KB744486.1:415626:537686:-1 gene:ENSAPLG00000009060 transcript:ENSAPLT00000009427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVMPPSKKPEGSGISVPSGLSQRYQDSDLSKALHDDEDLDFSLPAIRLDKGAMEDEEL
TNLNWLHESKNLLKSFGDSVLRSVSPVQDIGDDTPPSPAHSDMPYDAKQNPNCKPPYSFS
CLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKDRS
QSIGKGSLWCIDPEYRQNLIQALKKTPYHPYSHVFNTPPTSPQAYQSTSGPPIWPGSTFF
KRNGALLQDPDIDAATAMMLLNTPPEIQAGFPPGVIQNGARVLSRGIFPGARPLPINPIG
SMAVAVRNGITNCRMRTESEQSCGSPVVSGDPKEDHNYSSAKSSNHRSTSPASDSVSSSS
ADDQYEFATKGSQDSSEGSEVSFQSHESHSETEEEDKKQNRKETKDSLADSGYASQHKKR
QHLMKAKKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQ
KEQKETTKN
Download sequence
Identical sequences A0A2I0MPZ8 R0L0L9
ENSAPLP00000008742 XP_005028675.1.99704 XP_005506209.1.63277 XP_013037908.1.65836 XP_021259453.1.32913 XP_021259454.1.32913 XP_021259455.1.32913 XP_021259456.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]