SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008743 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008743
Domain Number 1 Region: 195-268
Classification Level Classification E-value
Superfamily ClpS-like 0.00000000000000262
Family Adaptor protein ClpS (YljA) 0.027
Further Details:      
 
Domain Number 2 Region: 745-824
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000131
Family ELL N2 domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008743
Domain Number - Region: 1133-1192
Classification Level Classification E-value
Superfamily RING/U-box 0.0636
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008743   Gene: ENSAPLG00000008919   Transcript: ENSAPLT00000009428
Sequence length 1731
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743275.1:2461577:2510878:1 gene:ENSAPLG00000008919 transcript:ENSAPLT00000009428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WCDERFDFQATFLQCLAKHVPNIYSAEMDPLLEKQEEMVQAAILYPLERYLFGEDPETFL
EKLQQSGTSQLCGKVFKGGETTYSCRDCAVDPTCVLCMDCFQNSIHKNHRYKMHSSTGGG
FCDCGDTEAWKAGPVCTKHEPGASGSPKENSECQLNEEVMEHSRRVFPSVIKYIVDMLIW
EEEKELPPELTISREKVDSYYCVLFNDEHHSYDHVIYSLQRALGCELSEAQLHTTAIDKE
GRRAVKAGRYASCQEAKEEIKRHSENVSQRPLHVEVLHADVMAHQKFALRLGSWLNKLMS
YSSDFRQIFCQICLKEETGSGKPCSISKLMLWDAKLHKGARKVLHELIFSSFFMEMEYKK
HFAVEFVKYYKALQKEYISDDHDRVLSVTALSVQMFTVPTLARHLIEEQSVITTITETLL
EVVPEYLDKNDKFNFQGYSQDKMNRVYAVIYDLRYVLISKPTVWTDRLRERFLEGFVSFL
RILTCMQGMEEIKRQIGQHIEVDPDWEAAISIQMQLKNILLMFQEWCACDEELLLRAYKE
CHKAVMRCSTNSSRLREKTAFHLCGHTLESRPYRVSLDPVSIHLPLSRTLAGLHVRLSKT
GSISRLHEFVSPEEFQVDLLVEYPLRCLVLVAQVAAEMWRRNGLSLISQVFYYQDVKCRE
EMYDKDIIMLQIGASLMDPNHFLLLILQRYELADAFRRIKPTKDQELIKQCNVLIEEMLQ
ILIYVVGERYVPGVSNVTKEDVTMREIIHLLCIEPMAHSAITKSLPENENNETGLENVID
KVATFKKPGVSGHGVYELKDECLKDFNMFFYHYTKTQHSKAEHTQKKRRKQENRDEALPP
PPPPDFCPAFSNVVRLLNCDVMMHILRTILQRAVELETHLWTEAMIQMVLHLLSLGLLEE
KQQLQKSPEEEVTFDFYHKASRMGSSALNAVNILMLLEKLKRIPQLEAQKDMINWILQMF
DTVKRMREKSSLTTVAATSVSEATKGDEVSKDKEKAERKRKAEAARLHRQKIMAQMSALQ
RNFIETHKLLYENTSEAQGKEDAIMEEESMSSAIDYSRIALGPKRGPSVVEKEVLTCILC
QEEQEVKLESAAMVLSACVQKSTALTQNRSRIVELSGDTLDPLFMHPDLPCGTHTGSCGH
VMHATCWQKYFEAMQLNFRQRLHVEQIFDLENGEYLCPLCKSLCNTVIPIVPLQAQKINS
EDAEAVAQILSLARWLEIILVRISGYSVKNAKEGEKQNALAFVNKGLGNSALEFNSILSF
GVQSSAKYSSSIKEMLILFATTIYRVGLKVAPNEADHRIPMMTWSTCAFTIQCIENLLET
EGKPLFGSLQNRQHSGLKALVQFAAAQRTTSPQVLIQKHLIRLLGVLLPNFKMEDTPSLL
EVDMFHVLVGVVLSFPSLYWEDAVDLQPSSISSAYNHLYLFHLTTLAHITQIVISSAKES
PTARSHDNSEEACSAQSFCREVCQYTSGCFSQDIPGWLVWDCVKKGIMPYLRCAALFFHY
LLGVSPPEELQQVSEEGQFKALCSYLSLPTNLFLLFQEYWDTVNPLLQRWCADPVVLSCL
KGKSIAIRYPRKRNSLIELPEDYSCLLNQASQFRCPRSSDDEQKHPVLCLFCGAMLCSQN
TCCQELVNGEELGACTSHALQCGAGVCMFLKIRECKVVLIEGKTRGCLYPAPYLDEYGET
DPGLKRGNPLHLCRERYRKLHLLWQQHCIIEEIARSQETNQIFFGFNWQLL
Download sequence
Identical sequences U3INC0
ENSAPLP00000008743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]