SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008766 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008766
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-22
Family BCR-homology GTPase activation domain (BH-domain) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008766   Gene: ENSAPLG00000009089   Transcript: ENSAPLT00000009451
Sequence length 1329
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742906.1:875381:889585:-1 gene:ENSAPLG00000009089 transcript:ENSAPLT00000009451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVSRFPEDEQLARIQNVIQELPPSHYRTLEYLIKHLTHLASFSNMTNMHTRNLALVWAP
NLLRSKEIEAVGCNGDAAFLEVRVQQLVIEFILNHVDQIFSKNRKASSAENIENAPIVRN
LSLPSASLPMKLVSLEEAQARSLSASHPARKERRENSLPEIVPVTGSLFHTVVDLPDSKR
KLSTKSKKWKSIFNLGRSGSESKSKLSRNGSVFVRAQKLSALEKATIRPAKSMDSLCSLP
VEGEDEKSRFKRAVTTGGFFVPVMKMRTGGTGSSYDLSKENEWEREGSAMGAKGSSELSG
DKAPCRTPQAKSPPEQLKVFRAAEDAENDQTCPKGSRMFYTSETAAKSGFPSSLFPLEAS
PRHQRKALNISEPFAVSVPLRVSAVISTNSTPCRVPAKDKPSLSSLEELSALEPQPLGPG
SGGPHEDGAGPREEGEATRTSPDSGSSPSQQSSEQSPTLEQTPASEVHAGMLPAGKAEQG
PLKMKDISPEGSCGQQDIQKAKPEEAPRLRDAVNLLHKPEETEEDPVNALLEPLWPEIQH
ELKIIEPEEELLILPAAVPKTGPISDSSSSQTNSFSSGPGQSPTLSEQKPACGTPQTTAQ
VPLFGASNVERPDSHHSCQSDVAAQQSCAPALPKPGTVPTGAAIPKNHHPVVEDSMSECL
TPPLDWKLHSQPEINEVPPTDTFSLSKGACSEPEKEKDSTCKLQKESEGHTRVHIQREKP
EIMPADGRDAFASKELSGAGIQELKEGNAVSRTHEAGEQDDEDTWTDNVQSLELVEPWED
HQWVTSPLHSPTFKDIQEKTIPELQPQSQRSETGLSLRPRFSRSLSLDSKDTVMTLWTIP
FPFIASCELPKTQPISPSSLGRAKQDENSTSLPEEPLKPEELRYPHDREETPAKQEEPSR
IPLSEPEEKKVDASKENPWSSKLELSLSYPNTPECSLETKNTKEELPISQDTALGGDAVT
KALCSATESGLSNKGEETPRKVKTRPSSLNLDTLLPAPDFFTFESLALPSATGHHLCGQK
EVKSSDSVPSLPTACPAVGKGVPWGSPFNAHVDLDLDYLAMAHATTGRRNSAPVSVSAVR
TSFMIKMCQARAVPVIPPKIQYTQIPQPLQAQNAAPPAEKKEAEAKQAGRQTQRVAWGHL
EPPKSPQTEKKAKAEKENSDPAQKDSACPWHSSLGSSLESSQSNHNPGLDAPVLRRKRTS
EGETAEDNPQSSKMERPSGFSKPSYRSRPGRPQSLILFSPPFPIMDHPSSSADSRVLLSP
IRSPTQTTSSSPICGDLSETSRTTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVIL
DGRSGRQIE
Download sequence
Identical sequences U3INE3
ENSAPLP00000008766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]