SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008773 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008773
Domain Number 1 Region: 128-223
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-36
Family Forkhead DNA-binding domain 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008773   Gene: ENSAPLG00000009084   Transcript: ENSAPLT00000009458
Sequence length 540
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743145.1:3676800:3697552:1 gene:ENSAPLG00000009084 transcript:ENSAPLT00000009458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSFPYRCTFRFPSTVIKIQFTSLYHKEEVKEEASSPPLRPLYPQISPLKIHIPEPDLRS
VVSPLPSPTGTISVPNSCPASPRGAGSSGYRFVHNITSDLQLAAEYAAKAASEQQADASG
GDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHN
LSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRS
APASPTHPGLLSPHSSGLQTPECLSREGSPIPHDHDFGSKLASVPEYRYSQSAPGSPVSA
QPVIMAVPPRPSTLVAKPVAYMPASIVTSQQPSCHAIHVVQQAPTVTMVRVVTSSANSAN
GYILTNQGTAGGAHEAAGAVLDLAGDHRGMDEKPTIAFAAIPTASRVIQTVASQMAQGVP
GQTVTILQQAAPVAIGQHQLPVRAVTQNGKHAVPTNSITGSAYALTNPLQLLAAQASSST
PVVVSRVCETGTEETAAASRSQDSSEPEVKRPRIEESSGAVPAQTGVITSTVPQGQATSE
Download sequence
Identical sequences U3INF0
ENSAPLP00000008773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]