SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008778 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008778
Domain Number 1 Region: 8-231
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-54
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 499-568
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.79e-20
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 436-504
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-16
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 
Domain Number 4 Region: 232-316
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000106
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008778   Gene: ENSAPLG00000009078   Transcript: ENSAPLT00000009463
Sequence length 1325
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742575.1:736778:765146:-1 gene:ENSAPLG00000009078 transcript:ENSAPLT00000009463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSAKRLNVNYQDADGFSALHHAALGGSLDLISLLLEAQATVDIKDSNGMRPLHYAAWQ
GRVEEPVRVLLRAAASVNMASLDGQIPLHLSAQYGHYEVSEMLLQHQSNPCLINKAKKTP
LDLACEFGRVAQLLLNSHLCVALLEGQSKDSTDPNYTTPLHLAAKNGHKEIIRQLLKAGI
EINKQTKTGTALHEAALYGKTEVVRLLLEGGVDVNIRNTYNQTALDIVNQFTTSHASKDI
KQLLREASGILKVRALKDFWNLHDPTALNVRAGDVITVLEQHPDGRWKGHIHDTQKGTDR
VGYFPPSIAEVISKRTECRHDPPPALPAQGTWGNALLPPPGRKAARREGAATGQGSLVIE
NARDKRATSCPALSLGASFAGPCCEAVLSSQGCKADPGTGPCPEGCPSPPHSSSPQPLPS
TGDDFLRPEQLLEGKDAEAIYNWLREFQLESYTANFLNAGYDVPTISRMTPEDLTAIGVT
KPGHRKKISTEIGQLSIAEWLPNYIPADLMDWLSAIGLPQYHKKLVNNGYDSITIVTDLT
WEDLQEIGINKLGHQKKIMLAVKKLRDLRKSLNQAETTLARRKVPGALDIVTIESLENGE
CQSPHTPKMTTFQDSELSYELQTAMSNSCHETLSIKNSQGMSRSQPGEHRGALPGLRALA
GQCFVPAPLQPLAGEPGQSGGSPLKERNLPEGTDQYARPTAQKGAGPAGPPAVTPCTPPQ
TPSKGTAPYVFMYPHVSLKSPTAPSLLGAEQPKTLAHPYPSFPSGQKSSLQTSAQKAFSY
LHSQCSPTEPPKAAAAPGTWQAGEQHNGGEGFKYKKRSHSLNRYALSDGEHEEEEGVPPX
GRSQMPRACLQAEAKVTRSQSFAIRAKRKGPPPPPPKRLSSVSSTPATEANGEQPPDPEQ
QSPVPQDMVDAGASPSDTSRSRTVRSLAAALEGTPGASPPKPLLAPKPLHVAQDSLSRAS
VDDRSYDGGDSGSKPRRRTLSEPSAPMTEAVQVGRTAPASCISFAEEGNLTIKQRPKPAG
HPKADTAVQDAEPSSQPAEPPCSAGKVLEFNLTESDTVKRRPRFKEREPLQAVLKAFSLA
GQAEVGGSPAPQYAQAQAGSMLAPRAGLAGDTFDDDSVEFRIAEIEKSILSLEKGIKKTP
SPTKAPSPTELLGTAVVRTPAPGTGTRQEARGTRASACHEASSLADVPTKHTSVASTKLV
FSGPKTIYQQVLQPSRHTVAPWAAPEAVPDVVGSLAAPSPLTLEASSKVSAKPLATAPGT
ALAQQRLEHTNCSLAAALQAAEKKITAEEVESPPGAVHSHSAKNILEDISNMFDDLADQL
DAMLD
Download sequence
Identical sequences U3INF5
ENSAPLP00000008778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]