SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008783 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008783
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 6.93e-29
Family Surp module (SWAP domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 663-772
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.37e-27
Family Ubiquitin-related 0.00000261
Further Details:      
 
Domain Number 3 Region: 116-196
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.73e-26
Family Surp module (SWAP domain) 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008783   Gene: ENSAPLG00000009057   Transcript: ENSAPLT00000009468
Sequence length 774
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743627.1:310157:321776:-1 gene:ENSAPLG00000009057 transcript:ENSAPLT00000009468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLLQPEEEPKEEAAPAKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNP
KFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQTAQQQLPQKVQAQVIQET
VVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRP
QHSLFNYFTKLVEQYTKILIPPKGLLIKLKKEAENPKEVLDQVYYRVEWAKFQERERKKE
EEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGES
EEVEMEVESDEEDEKQEKTDEPPTQLDQDTQVQDMDEGSDDEDESQKVPPPPETPMPPPL
PPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLE
QRDRSIREKQSDDEVYAPVGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEK
VTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDSKEKIGPSKPNEMPQPPPP
SSASNPPASAQPITSVPRPPTMPPPVRAAVVSAVPVMPRPPMTSVVRLPPGSVIATPMPP
IIHTPRINVVPMPPSAPPIMSPRPPPMIVPTAFVPAPPVAPVPSPAPMPPVHPPPPMEDE
PVSKKLKSEDSLIPEEEFLRRNKGPVTVKVQVPNMQDKTEWKLNGQVLVFTLPLSDQVSV
IKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMTSGSLIHLALKERGGRKK
Download sequence
Identical sequences U3ING0
ENSAPLP00000008783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]