SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008831 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008831
Domain Number 1 Region: 15-144,405-525
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 8.9e-88
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00022
Further Details:      
 
Domain Number 2 Region: 211-378
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.32e-54
Family Group II chaperonin (CCT, TRIC), apical domain 0.0000000757
Further Details:      
 
Domain Number 3 Region: 144-215,369-404
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.01e-28
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008831   Gene: ENSAPLG00000009108   Transcript: ENSAPLT00000009516
Sequence length 545
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB752849.1:1019:7210:1 gene:ENSAPLG00000009108 transcript:ENSAPLT00000009516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFFFSLCALGQNMKRESGRKVQTGNITAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMT
NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT
VIIGAYRKALDDMISILKKIGTPVDVNNREMMLKIIKSAINTKAINRWSDLACTIALDAV
KTVEFEENGRKEIDIKKYAKVEKIPGGFSEDSCVLRGIMVNKDVTHPRMRRLIKNPRIVL
LDCSLEYKKGESQTDIEITREEDFARILQMEEEYIQQICEDLMRVKPDLVITEKGISDLA
QHYLMRANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGTGARLFEVKKIGDEYF
AFITDCKDPKACTIILRGASKEILAEVERNLQDAMQVCRNVLIDPQLVPGGGATEMAVSH
ALTEKSKGMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGSQTWGV
NGETGTLVDMKDLGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDEQSKQPAAT
EASQE
Download sequence
Identical sequences U3INK8
ENSAPLP00000008831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]