SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008849 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008849
Domain Number 1 Region: 564-634
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.26e-16
Family Rad21/Rec8-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008849   Gene: ENSAPLG00000009130   Transcript: ENSAPLT00000009534
Sequence length 637
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742707.1:17845:33336:1 gene:ENSAPLG00000009130 transcript:ENSAPLT00000009534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQDNDFGDFGMDDREMMREGSAFEDD
MLVSTSASNLLLEPEQSTSHLNEKANHLEYEDQYKDDNFGEGNDGGILDDKLLSNNDGGI
FDDPPALSESGVMMPEQPPHDDMDDDDNVSMGGPDSPDSVDPVEPLPTMTDQTTLVPNEE
EAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLM
MWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKDFE
NPEVPREENFLSRNRRPEICFDPNIDEPILEEPSRLQESMMEGSRTNLDESVMPPPPPQT
GVKRKLQQVEPEPVIPHPPSQQLEIPPVEMPPEEPQNICQLIPELELLPLQNKSIDTIML
NTNSPREEDGTGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAA
AKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
Download sequence
Identical sequences U3INM6
ENSAPLP00000008849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]