SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008853 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008853
Domain Number 1 Region: 245-346
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-28
Family Pleckstrin-homology domain (PH domain) 0.0000109
Further Details:      
 
Domain Number 2 Region: 117-228
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-27
Family DEP domain 0.00000491
Further Details:      
 
Domain Number 3 Region: 6-102
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-23
Family Pleckstrin-homology domain (PH domain) 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008853   Gene: ENSAPLG00000009140   Transcript: ENSAPLT00000009538
Sequence length 347
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743722.1:50309:66804:-1 gene:ENSAPLG00000009140 transcript:ENSAPLT00000009538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REPMRIREGYLVKKGSMFNTWKPMWVVLLEDGIEFYKRKSDNSPKGMVPLKGSTINSPCQ
DFGKRTFVFKLTAAKQQDHFFQAAYLEERDAWVRDIKKAIQCIDGGQRFARKSTRKSIRL
PETINLSALYLSMKDPEKGIKELKLEKDKKVFNHCFTGTSVIDWLVSSNSIRNRKEGLML
ASSLLSEGYLQPAGDTSKAAAEGLSDTPFLDLSDAYYYFPDSGFYCEGNSSDDDVVLKEE
FRGLVVKQGCLLKQGHRRKNWKVRKFVLREDPAYLHYYDPAGGEDPLGAIHLRGCVVTAV
EDMPDSKKCDVENNLFEIITANDVHYYLQAASSTERTEWIKAIQVVS
Download sequence
Identical sequences U3INN0
ENSAPLP00000008853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]