SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008952 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008952
Domain Number 1 Region: 126-254
Classification Level Classification E-value
Superfamily PH domain-like 2.65e-30
Family Pleckstrin-homology domain (PH domain) 0.0000186
Further Details:      
 
Domain Number 2 Region: 296-388
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008952   Gene: ENSAPLG00000009266   Transcript: ENSAPLT00000009637
Sequence length 389
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743461.1:177846:181647:-1 gene:ENSAPLG00000009266 transcript:ENSAPLT00000009637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDSLASIPFIDEPTSPSIDLKAKHVPASSVVSSAMNSAPAVATSPSSPTFAFALSRHYSQ
DCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGKILSSLGTSEDTRSKRHSTSDLSD
VTFSDVRKEGWLHYKQILTKXGRKVGGGIRQWKRVFAVLRTHSLYLCKDRREAVTCGPAP
GEEEQPISIRACLVDISYSETKRKHVFRLTTADFCEYLFQAEDREDMLAWIKVIRENSKA
EGEVRATTHSPPPQHSRGALALNNPMVVFPPDESSSQKAPWGINLMKKNKKSAPRAFGVR
LEDCQPAPDNKNVPLIVEACCKVVEDRGLEYMGIYRVPGNNAVVSSLQEQLNKGATEINL
QDERWQDLNVISSLLKSFFRKLPEPLFTD
Download sequence
Identical sequences U3INX9
ENSAPLP00000008952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]