SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009012 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009012
Domain Number 1 Region: 156-502
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.88e-119
Family Cullin repeat 0.0000000000311
Further Details:      
 
Domain Number 2 Region: 501-773
Classification Level Classification E-value
Superfamily Cullin homology domain 8.5e-102
Family Cullin homology domain 0.000000000631
Further Details:      
 
Domain Number 3 Region: 773-861
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-28
Family SCF ubiquitin ligase complex WHB domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009012   Gene: ENSAPLG00000009282   Transcript: ENSAPLT00000009698
Sequence length 861
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743323.1:93619:112846:-1 gene:ENSAPLG00000009282 transcript:ENSAPLT00000009698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVFMFPTGFSSPNPPAAAQEVRPATDGNSSSSSSCKKRKLNNSSNSNSEREEFAGVASSN
HHLQKKLRFEDSLDFIGLDVKMAEESSSSSPAASSQQQHQQQLKNKSLLISSVAVGHHAN
GLTKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSI
KYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCW
QDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRTHIISDQKVQNKTIDGILLL
IERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEHRFLEETNRLYAAEGQRLMQEREVPEY
LHHVNKRLEEEADRIITYLDQSTQKPLIATVEKQLLGEHLTAILQKGLNHLLDENRIQDL
SLLYQLFSRVRGGVQVLLQHWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDVC
FLKNEKFVNAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMII
FRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDME
LSKDIMIQFKQQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFY
LGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATG
IEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFTCNDDFRHKLFRIKINQIQMKETV
EEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIES
LIDRDYMERDKENPNQYNYIA
Download sequence
Identical sequences U3IP39
ENSAPLP00000009012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]