SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009059 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009059
Domain Number 1 Region: 605-674
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.27e-17
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 682-757
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-16
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 
Domain Number 3 Region: 762-837
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000343
Family SAM (sterile alpha motif) domain 0.063
Further Details:      
 
Domain Number 4 Region: 95-156
Classification Level Classification E-value
Superfamily MPN010-like 0.0000575
Family MPN010-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009059   Gene: ENSAPLG00000009279   Transcript: ENSAPLT00000009745
Sequence length 976
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743948.1:325265:385832:1 gene:ENSAPLG00000009279 transcript:ENSAPLT00000009745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGGLRALHLVEDLRGLLE
MMEADEREGLRCQVPDSTAEALIEWLQSQMTNGHLSGNGDVYQERLARLENDKESLVLQV
SVLTDQVEAQGEKIRDLEFCLEEHREKLNATEEMLQQELLSRTSLETQKLDLMAEISNLK
LKLTSVEKDRVDYEDRFRDTEDLIQEINELRLRVGEMDNERFQYEKKLKTTKDELAALKE
KLEQKEAEVKRLQEKLVSNKSLNKFQLGPQKDIEVQKMKKAVESLMAANEEKDRKIEELR
QSLNRYKKVQDMVILAQGKKGKESDSEDFLHSGSVSTVLLDTPTLTDPEKSPSPTPVTAS
PIHDEFNMNIQEENSLQIHTSVLQISIPSFSSTSKSSEIVAEKVKTQPRSDPASDLSEGR
STGSSPGTQLCDGPATSSLQKSSSLSSLKKETCEAVKPPMEGNNFATLPPKSPSHGVTGD
EDSFGTRKARSSFGRGFFKIKNNKRTASAPNLAETEKGSADHLDLAGLPPRPKETDSLQM
TPPSPDSKKKARGIKKFFGKLKRSQSTTFNLDDMSETEFKRGGTRATAGPRLGWSRDLGQ
SHNELDMPFAKWTKEQVCNWLQDQGLGSYISNGRQWILSGQTLLQASQQDLEKELGIKHP
LHRKKLQLALQALGSEEENNHGKLDYHWVTRWLDDIGLPQYKTQFDEGKVDGRMLHYMSM
DDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDESSVTPSEVTQWTNHRVMEW
LRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIG
QDAQQKKREAMESPDYVLLTATAKVKPKKLAFSSFGSLRKKKQDDVEEYVCPMELGRASG
SGSKKGFKPGLDIRVYDDDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDEMFKDF
ATRSPSTSITDEDSNV
Download sequence
Identical sequences U3IP86
ENSAPLP00000009059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]