SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009082 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009082
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-45
Family BAR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 235-363
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-19
Family BCR-homology GTPase activation domain (BH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009082   Gene: ENSAPLG00000009384   Transcript: ENSAPLT00000009769
Sequence length 437
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743855.1:283389:290817:1 gene:ENSAPLG00000009384 transcript:ENSAPLT00000009769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGVDADKRSKKLPLTMPHGS
GRDRCRPSPASPSPCRKMLRLCGEAEDKLAQELIQFELQVERDVIEPLFVLAEVEIPNIQ
KQRKHLAKLVLDMDSSRTRWQQSAKSSSLSSNLQPSGAKADALREEMEEAANRVEICRDQ
LSADMYSFVAKEIDYANYFQTVSAASEYHRKSLALLQNVLPQIKAQQEAWMEKPSFGKPL
EEHLAVSGREIAFPVEACVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYS
ADPHAIAGGDRPRFGESAFPLLSWLLLAAGIPEQEKRLQALWSACEKLPKANYNNIRYLI
KSLGHERFLPQHEGSTRSPWRGCRAGERDPRGCWRGEGWIKPIRERGRAVAGPLIQHADW
FFPGDIEFNVTGNYGSP
Download sequence
Identical sequences U3IPA9
ENSAPLP00000009082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]