SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009133 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009133
Domain Number 1 Region: 116-263
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.95e-32
Family UAS domain 0.026
Further Details:      
 
Domain Number 2 Region: 333-429
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-20
Family UBX domain 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000009133
Domain Number - Region: 7-35
Classification Level Classification E-value
Superfamily UBA-like 0.0176
Family UBA domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009133   Gene: ENSAPLG00000009406   Transcript: ENSAPLT00000009821
Sequence length 430
Comment pep:novel scaffold:BGI_duck_1.0:KB742965.1:41632:50024:1 gene:ENSAPLG00000009406 transcript:ENSAPLT00000009821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SESVIFFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQVNT
ADHRIYSYVVSRPQPRGLLGWGYYFMMLPFRFTYYTLLDIFRFALRFIRPDPRSRVTDPV
GDIISFIHMFEEKYGRIHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDTDEFCRNTL
CVPEVITLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAVIMLKDRRMTVVGRLEGLI
QADDLINQLIFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLASLRADSTAAKASRG
ETAAGESKLSAREAVVLSWMLATLQEEKERKSECLPPEPHPDDPESVKIIFKLPNDSRVE
RRFHFTQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCLPTEEWPNPPTLQEAGLSHTE
VLFVQDLTDD
Download sequence
Identical sequences U3IPG0
ENSAPLP00000009133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]