SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009173 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009173
Domain Number 1 Region: 273-316
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000488
Family UBA domain 0.007
Further Details:      
 
Domain Number 2 Region: 2-32
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000166
Family Ubiquitin-related 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009173   Gene: ENSAPLG00000009465   Transcript: ENSAPLT00000009862
Sequence length 320
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744986.1:66267:69551:1 gene:ENSAPLG00000009465 transcript:ENSAPLT00000009862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLIYCGRKLRDDQTLDFYGIQSGSTVHVLRKSWPEPDQKPEPVDKVAAVREFRVLHTAL
HSSPAYRDAVFKMLGNKESLDQIIVATPGLSSDPVALGVLQDKDLFSVFADPNMLDTLIP
AHPALVNAIVLVLHSVAGSTPLPAPETSSRGMSSSSYRDMPGGFLFEGLSDDEDDFHQST
RSTPSSSTSGSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
SPMSSSVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIHDDELSLRAL
QATGGDIQAALELIFAGGAP
Download sequence
Identical sequences U3IPK0
ENSAPLP00000009173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]