SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009212 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009212
Domain Number 1 Region: 611-862
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.6e-64
Family SAICAR synthase 0.00011
Further Details:      
 
Domain Number 2 Region: 873-1029
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 2.22e-39
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009212   Gene: ENSAPLG00000009439   Transcript: ENSAPLT00000009901
Sequence length 1031
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:1208488:1246775:1 gene:ENSAPLG00000009439 transcript:ENSAPLT00000009901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWTEEEVKALLSVWSEKSIRKQLRGTLRNKGIFIYIAKRLQELGVCRDWKQCRAKYKNLN
LPEKFRPSKKLTTRQSADCWRVPINTGLTGQVCPQTGYYTQACSAAAVCASKVANEGGKH
WTVDEVRALIHIWSDKNIQQQLEGTVRNKRIFEHVAARLRKFGIVRDWKQCRTKYKNLKH
EYRSVKNAQGSGSTSKSMKFFNELDAILGHSTMEQGLHFERDKIAMQYCNRFGSQASKSV
TEEKVKLKSEPQQYTEVVRSMTSIQHPQLPLRNVGAGRKIKLMRVITINDTGAGRHWSDN
EVRALINIWSDEKIQQMLEGATRNKEIFEEIARRLMKRGIDRDWKQCRTKYKNLKYEYRA
LQKENEHLGNPRRKMRFYEEIDDILKRQPLNGVTVKPSARTSKKQSSLIKFTPQSIEEKN
PGLMPEKDRAICAVNADAVEMSPVPLKKSASENTILQFQKLLTERVHTEEYAKLAEELPV
PSSTKITESYPLLFYHSHLFLANSDKSSVGKYVNSCNSCNGCKSSAQPKYSRTFYQHVQH
KCAGKTPYRLKKQTDNQTSDGHSGPAWDYLIEFYCVFESDRRAPEARRESSPSERESGSE
KVVLKRKNCSVELKLGKKVNEGKTKEVYELPDIPGCVLMQSKDQITAGNAARKDRMEGKA
AISNTTTSCVFQLLQEAGIKTAFVRKHSDTAFIAAHCEMIPIEWVCRRIATGSFLKRNPG
VKEGYKFYPPKIEMFFKDDANNDPQWSEEQLIEAKFSFAGLTIGQTEVDIMARSTQAIFE
ILEKSWQPQNCTLVDLKIEFGVNILTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDL
KEVTPEALQMVKRNFEWVAERVELLLKTKSQGRVVVLMGSPSDLSHCEKIKKACATFGIP
CELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLS
ADWGAQDVWSSLRLPSGLGCPTTLSPEGAAQFAAQIFGLNNHLVWAKLRSSMLNTWISLK
QADKKLRECTL
Download sequence
Identical sequences U3IPN9
ENSAPLP00000009212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]