SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009226 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009226
Domain Number 1 Region: 323-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-69
Family Protein kinases, catalytic subunit 0.0000000873
Further Details:      
 
Domain Number 2 Region: 743-885
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.22e-56
Family FAT domain of focal adhesion kinase 0.00000515
Further Details:      
 
Domain Number 3 Region: 132-184
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000237
Family Second domain of FERM 0.00099
Further Details:      
 
Domain Number 4 Region: 188-271
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000393
Family Third domain of FERM 0.002
Further Details:      
 
Domain Number 5 Region: 8-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000196
Family First domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009226   Gene: ENSAPLG00000009501   Transcript: ENSAPLT00000009915
Sequence length 888
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB747499.1:11364:25952:-1 gene:ENSAPLG00000009501 transcript:ENSAPLT00000009915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLEAEREEMRILKVCFYSNSFNMGKNFKLVKCPVTTEIRQEVIKSILVSGRIGPDIKLAE
CYGLRLKHVKGSKPPHPPSSITLLVWGGWGKLPKEHPMALGTPFAGVPPPCVTGPLWVPM
GPLMRVGSLLPRKEVGLDLFFPSQMQENLKPKQFRKMIQQTFQQYALLREEECILKFLHT
LATFANIDQESYRCELIQGWNITVDLVIGPKGIRQMTSKEAKVGVPEAEFKHIKSIRCSS
VEEGRAVLQLGLSGXDGYCLLQGGLETSLIAFPRRGGCPGGRTPPPKTIPXEVLRAPTPT
RWVSRAPPAPNCPCLSLQKGERVNVAVKTCKKDCSPENKDKFLSEAVLMKKLDHPHIVKL
IGIAEEEPTWIIMELYPYGELGQYLEQNKHCLAVPTLILYALQISKALAYLEAINCVHRD
IAVRNILVASPECVKLGDFGLSRYIEDEEYYKASITRLPIKWMSPESINFRRFTXASDVW
MFAVCMWEILSYGRQPFFWLENKDVIGVLERGDRLPKPDLCPPVLYTLMTRCWDYDPSER
PKFKDLVCSLSDIYLMEKELAKEQERNNRHRPPKILEEPLSFQEPPPKPSRPRYKPPPQN
NLLAPKLQFQVPEGLCASSPTLTSPIEYQSPATLLHSPEIRAEPSITSGSVRQEEDFLRP
SSREEAQKLWELERLKMRQVLDKQQKQMVEDYQWLRQESSALDPTVFMNNNTPLMLPEKE
IDYNGIAEFTGPPQKPPRLGAQSIQPAPTANLDRTDDTVYSNVMDLVRAVLQLKNEISLL
PPEGYILVVKNVGLSLRKLIGSVDEILPVLPAASRTEIEGTQKLLNKDLADLINKMRLAQ
QNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKLQANLVKLPVS
Download sequence
Identical sequences U3IPQ3
ENSAPLP00000009226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]