SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009355 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009355
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.86e-21
Family Heat-shock transcription factor 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009355   Gene: ENSAPLG00000009652   Transcript: ENSAPLT00000010046
Sequence length 115
Comment pep:novel scaffold:BGI_duck_1.0:KB743307.1:480041:480731:1 gene:ENSAPLG00000009652 transcript:ENSAPLT00000010046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLKKLWEIVGSNRFQSLWWGDNGNCIVIVEKLFKMELLTRRGPLQPFEIDSMKTFIRQL
HLYGFCKMQWDLTRSSSCDEFLADKGAVSAFSKLLFYHNPYFKRDYPHLLRRCKR
Download sequence
Identical sequences U3IQ32
ENSAPLP00000009355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]