SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009359 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009359
Domain Number 1 Region: 173-343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000353
Family BCR-homology GTPase activation domain (BH-domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 13-69
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000185
Family DEP domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009359   Gene: ENSAPLG00000009617   Transcript: ENSAPLT00000010050
Sequence length 480
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742387.1:44192:66234:-1 gene:ENSAPLG00000009617 transcript:ENSAPLT00000010050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVDCLHELLGSNQNFGPEVTRSQTVKLLKKFLKNHVIEDIKGRWGKEDFQDDGHLYRFPP
SSPLKPYPKKPSYGKEVIKFPDWNETKVGVSQEHIPVKSIIYNNSEMWYKRHSIAIGEVP
ACKLVLRRELTQAHIEEIWKSMTLSRLQKVLGLNSLDEVLDTKLVNSKHIVQNAYNVNKQ
GIVILEDKSKDLPHWILSAMKCLANWPSCSDLKQPTYSGFERDVFKTIVDYFGQMKEPLL
TFNFFDIFVCVLGLLQKHSKAVEALQISCLLLPPENRRKLQLLVRMMARICHHLPPLSES
VRTRTLMVQAFSRCILCSKDEMDLDELLAAKLVSFLMDNYQEILSVPSSLKSSIEEHVVH
VQRVQIKYTGADTDATFPAPSFCHQISTDEFEYQRATGSQEPLAALLEEIAMNKEISVKD
KKKKLKQFQKSYPEVYKERFPTPETEAVLFPEKSKQKPPILMWALKKPFQPFHRTRSFRM
Download sequence
Identical sequences U3IQ36
ENSAPLP00000009359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]